32,364 Free 3D Models of Stl

gameterraindungeons and dragonswargamingrpgscenerypathfindermedievalarchitectureboard game
NTM 28 36 series Motor Frame (49 x 47 x 58 mm) - RC
printing stl
Venus Frieze Wall
printing medieval
Sewer Wall
printing medieval
Cut-Stone Curved Floors
printing medieval
Sphinx
printing mythology
Ring For Hand Cranked Heart Gear
printing stl
cd tray car smartphone holder huawei p20 pro/mate s
printing stl
Toys for boys-ships/modular handy size GC hull, classic bow, full set in printable sections
printing ship
Hot shoe clamp
printing astronomy
EZ Fit Pipe Cap for 3/4" Sched 40 PVC
printing stl
Toyota R22 540 Motor Cover
printing stl
AM8 Y-Axis Switch Mount when Bed Knob Hits Rod Mount
printing stl
Cooler Master HAF 922 replacement foot
printing stl
Mom Heart by Techie_Baksh
printing mother
Alluminium Ladder Foot
printing stl
Floor support Cello
printing stl
Storm king's Thunder Hardcover complete coin
printing stl
Motor Pinion Generator / Customizer. Mod0.8, 32p, 48p, with hole for M3 or M4 screw grub, D-shape or key MyRCCar compatible
printing stl
You are too close to me mask hook
printing stl
Battery Holder 3S 300mah TWIG XL
printing stl
Spool Holder - 20x20 Profile
printing stl
GiJoe 12" Adventure Team - Falcon - Estrela - Secret Agent Suitcase
printing stl
Christmas Tree Vase
christmastree
Caca Arale cortador de galletas - cookiecutter
printing stl
Tank RC. Track
printing military
Cut Stone Square Window
printing medieval
Nema holder for Ultimaker quiet retraction
printing stl
iRobot Clearance Template
printing stl
Martian Fighting-Machine
printing space
Wall Storage Bins
printing tools
Amphora rack with 4 amphoras scaled for 28mm tabletop terrain
printing stl
My Customized RC Car Motor PinMYGEAR,15Z,HD12mm,HE9mm,GT 6m15Z,Mod1,11mmHEm,%mmD holeion Generator / Customizer. Mod1, 32p, 48p, with hole for M3 or M4 screw grub, D-shape or key MyRCCar compatible
printing stl
hearing protection wall mount
printing tools
Handle jig my third hands COVID19
printing tools
Stone Gatehouse
printing medieval
Luno Tri Spinner + Design Tutorial - Public Domain
printing stl
Water Gun Manivelle
printing toy
Obox'ob First Demon Prince
printing fantasy
Raspberry Pi IoT
printing stl
Mouse Guard Inspired - Axe
printing stl
Vaso de los Blanquizares de Lébor | Vase from Blanquizares de Lébor
printing history
Tudor Wall Variations
printing medieval
Dynamic Floor Smooth and Cut Stone Faces
printing medieval
Giant Mushrooms scaled for 28mm tabletop (modular terrain, easy to print)
printing stl
Parameter-Driven Threaded Container
printing stl
E3D Adapter for Velleman K8200 with K8203 Direct Drive
printing stl
DARPin in Complex with IL-4 (two models, snap together) PDB 4YDY
printing science
1/4"-20 UNC SAE Acorn Nuts High Crown and Low Crown
printing stl
The Bearded Yell
charactermale
Customizable magnetic Flashforge Creator Pro Leveling Indicator holder
printing stl
Hovership MHQ ARM 11 Degree Tilted Motor Mounts
printing stl
Water tank trailer model 1/56
vehiclewater
Precision Screwless Vise
printing stl
Makerfarm Prusa i3v one tool leveling bracket
printing stl
Tudor External Wall
printing medieval
Wemos D1 with DHT Temperature Humidity sensor for Domoticz
printing stl
Segnavento
printing stl
prusa i3 - body for hot end, feeder direct drive and bowden adapter
printing stl
Deck Clip Replacement For GI Joe USS FLagg
printing stl
Cruze (and others) coil connector lock tab
printing stl
Anycubic Kossel Plus Heated Bed Leveling Clamps (with STEP files)
printing stl
4mm Guide Rod Faceplate for NEMA 17 Stepper Motor
printing stl
Open ChemWare: Retort Stand
printing science
HICTOP 3DP-17 ATHORBOT A01 Prusa i3-Clone 20x20-ITEM-Frame Tool-Tray
printing stl
Tevo Tornado Z-axis Damper Bearing
printing stl
Star Wars Tie Fighter 1/72 Cockpit Detail Parts
printing stl
Throw-away slick wheel for RC car (Traxxas E-Revo 1:16 but adaptable)
printing stl
JG Aurora A3 y axis bed mount
printing stl
Iron Man bust with Arc Reactor
characterprinting
Castle Bracelet
printing jewellery
Spike Wall Trap
printing medieval
Stand for HP dock
printing stl
C-Hubs LRP S8 Rebel BX 133004
printing toy
iRobot Create2 Bin
printing stl
Altoids pool
printing stl
Ruined Diagonal Walls
printing medieval
Space Girl
printing space
toda vida vale
printing stl
M8 Thread
printing stl
Asteroids
low poly space
Dwarven Portal
printing stl
Floss 3 GoPro and Insta360 One X Flosstyle
printing stl
lasercut spoolholder for 2300g spools
printing stl
Star Wars Kenner X-Wing Fighter Display Stand
printing stl
Creality Ender 3 - LED module holder
printing stl
Alphabet for children. F G H I J
printing stl
Caliburn upgrade to use OD: 40mm ID: 36mm (metric) aluminium plunger tube including the new takedown magwell design
printing stl
LM2596 + Micro USB Buck Converter enclosure for IKEA LED light chain
printing stl
Food Not Bombs Carrot key chain
printing stl
MEAN WELL LRS-350-12 & Fused Power Switch PSU Cover
printing stl
Parametric RND / Korad / KA3005P / KA3005D / KA3005 / Lab Power Supply Desk Stand
printing stl
Neptune Apex Trident reagent needle/tube guide v2 with reagent label
printing fish
Caribou/Zaribo Spoolholder Sidemount
printing stl
Creality Ender 3 Pro - Vertical Extruder Motor Mount
printing stl
XYZ 20mm Calibration Cube with smart axis reference.
printing stl
Band Saw Blade Wall Mount Holder
printing stl
Stanley Bailey Chisel compatible wall mount
printing stl
Desk benchtop cable fascia filler plug grommet
printing stl
Capsule Box
printing stl
Earthing, TENS, ESD, EMG, EKG Sensors Electrode Patches for diam 4 mm Red Round Connector
printing earth
31701 - 31800 of 32,364 Next page
/ 324